PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010924067.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 298aa    MW: 32750.2 Da    PI: 10.2098
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010924067.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1661.3e-51121371128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+v+yL++kv++++++l  +i e+d+yk++Pw Lp k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + + 
  XP_010924067.1  12 LPPGFRFHPTDEELLVHYLCRKVSHEPFSL-PIIGEIDLYKFDPWVLPGKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVISV- 104
                     79**************************99.88***************8777899***********************************9999. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +g+  g+kk Lvfy grapkg+kt+W+mheyrl
  XP_010924067.1 105 GGRRLGIKKALVFYVGRAPKGSKTNWIMHEYRL 137
                     999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-655173IPR003441NAC domain
PROSITE profilePS5100559.11712173IPR003441NAC domain
PfamPF023655.4E-2713137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGSREMASQL GLPPGFRFHP TDEELLVHYL CRKVSHEPFS LPIIGEIDLY KFDPWVLPGK  60
ALFGEKEWYF FSPRDRKYPN GSRPNRVAGS GYWKATGTDK VISVGGRRLG IKKALVFYVG  120
RAPKGSKTNW IMHEYRLCDA APSDSTKGQP TASATMPRPR RLDQWVLCRI YKKSYGVQHQ  180
KTSALNSRGQ TTHVAAAPLT HAGLHCYQSK LDQLIAKPIM DSYRSHCLQD STAVPPLCRV  240
KSPSKVLGGS CVDEEXFLLP ASAPAAATAT ASAASRKSKP GRYRGDGAGD PSTPSPTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-8611787173NAC domain-containing protein 19
3swm_B2e-8611787173NAC domain-containing protein 19
3swm_C2e-8611787173NAC domain-containing protein 19
3swm_D2e-8611787173NAC domain-containing protein 19
3swp_A2e-8611787173NAC domain-containing protein 19
3swp_B2e-8611787173NAC domain-containing protein 19
3swp_C2e-8611787173NAC domain-containing protein 19
3swp_D2e-8611787173NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00360DAPTransfer from AT3G15500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010924067.10.0PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 72-like
SwissprotQ9LDY89e-89NAC55_ARATH; NAC domain-containing protein 55
TrEMBLA9PFM07e-91A9PFM0_POPTR; Putative uncharacterized protein
TrEMBLB9T6P46e-90B9T6P4_RICCO; NAC domain-containing protein, putative
STRINGPOPTR_0011s12400.13e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP53893761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.13e-89NAC domain containing protein 3